Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups


  1. Avatar for Hold My Beer 11. Hold My Beer 2 pts. 10,032
  2. Avatar for GENE 433 12. GENE 433 1 pt. 9,932
  3. Avatar for freefolder 13. freefolder 1 pt. 9,835
  4. Avatar for FoldIt@Netherlands 14. FoldIt@Netherlands 1 pt. 9,823
  5. Avatar for DW 2020 15. DW 2020 1 pt. 9,811
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 9,704
  7. Avatar for FoldIt@Poland 17. FoldIt@Poland 1 pt. 9,410
  8. Avatar for Italiani Al Lavoro 18. Italiani Al Lavoro 1 pt. 9,135
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 8,365

  1. Avatar for frood66 31. frood66 Lv 1 31 pts. 10,052
  2. Avatar for actiasluna 32. actiasluna Lv 1 29 pts. 10,043
  3. Avatar for Norrjane 33. Norrjane Lv 1 28 pts. 10,041
  4. Avatar for nicobul 34. nicobul Lv 1 27 pts. 10,036
  5. Avatar for aznarog 35. aznarog Lv 1 26 pts. 10,030
  6. Avatar for joremen 36. joremen Lv 1 25 pts. 10,030
  7. Avatar for Merf 37. Merf Lv 1 23 pts. 10,029
  8. Avatar for MicElephant 38. MicElephant Lv 1 22 pts. 10,020
  9. Avatar for Marvelz 39. Marvelz Lv 1 21 pts. 10,010
  10. Avatar for fiendish_ghoul 40. fiendish_ghoul Lv 1 20 pts. 10,009

Comments