Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for frood66 31. frood66 Lv 1 31 pts. 10,052
  2. Avatar for actiasluna 32. actiasluna Lv 1 29 pts. 10,043
  3. Avatar for Norrjane 33. Norrjane Lv 1 28 pts. 10,041
  4. Avatar for nicobul 34. nicobul Lv 1 27 pts. 10,036
  5. Avatar for aznarog 35. aznarog Lv 1 26 pts. 10,030
  6. Avatar for joremen 36. joremen Lv 1 25 pts. 10,030
  7. Avatar for Merf 37. Merf Lv 1 23 pts. 10,029
  8. Avatar for MicElephant 38. MicElephant Lv 1 22 pts. 10,020
  9. Avatar for Marvelz 39. Marvelz Lv 1 21 pts. 10,010
  10. Avatar for fiendish_ghoul 40. fiendish_ghoul Lv 1 20 pts. 10,009

Comments