Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for Simek 121. Simek Lv 1 1 pt. 8,930
  2. Avatar for marsfan 122. marsfan Lv 1 1 pt. 8,906
  3. Avatar for Perhonen 123. Perhonen Lv 1 1 pt. 8,873
  4. Avatar for jimmy Cashew 124. jimmy Cashew Lv 1 1 pt. 8,871
  5. Avatar for vivianlee 125. vivianlee Lv 1 1 pt. 8,842
  6. Avatar for b.maierhofer 126. b.maierhofer Lv 1 1 pt. 8,797
  7. Avatar for janikavillamor 127. janikavillamor Lv 1 1 pt. 8,782
  8. Avatar for harvardman 128. harvardman Lv 1 1 pt. 8,774
  9. Avatar for pedRamezani 129. pedRamezani Lv 1 1 pt. 8,748
  10. Avatar for wozzarelli 130. wozzarelli Lv 1 1 pt. 8,725

Comments