Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for MrZanav 91. MrZanav Lv 1 1 pt. 9,511
  2. Avatar for kvasirthewise 92. kvasirthewise Lv 1 1 pt. 9,496
  3. Avatar for oureion 93. oureion Lv 1 1 pt. 9,410
  4. Avatar for Louis_LIB 94. Louis_LIB Lv 1 1 pt. 9,381
  5. Avatar for pfirth 95. pfirth Lv 1 1 pt. 9,376
  6. Avatar for mberna00 96. mberna00 Lv 1 1 pt. 9,374
  7. Avatar for alwan2018 97. alwan2018 Lv 1 1 pt. 9,359
  8. Avatar for Knoblerine 98. Knoblerine Lv 1 1 pt. 9,355
  9. Avatar for pandapharmd 99. pandapharmd Lv 1 1 pt. 9,347
  10. Avatar for rabamino12358 100. rabamino12358 Lv 1 1 pt. 9,326

Comments