Placeholder image of a protein
Icon representing a puzzle

1663: Revisiting Puzzle 125: Ice Binding Protein

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 16, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in cold water fishes; it binds and prevents the growth of ice crystals. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNHAVPLGTTLMPDMVKGYAA

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,170
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 76 pts. 10,170
  3. Avatar for Void Crushers 3. Void Crushers 56 pts. 10,159
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 41 pts. 10,136
  5. Avatar for Gargleblasters 5. Gargleblasters 29 pts. 10,135
  6. Avatar for Go Science 6. Go Science 20 pts. 10,131
  7. Avatar for Contenders 7. Contenders 14 pts. 10,115
  8. Avatar for HMT heritage 8. HMT heritage 9 pts. 10,094
  9. Avatar for Russian team 9. Russian team 6 pts. 10,076
  10. Avatar for Marvin's bunch 10. Marvin's bunch 4 pts. 10,052
  1. Avatar for agcantos 131. agcantos Lv 1 1 pt. 8,687
  2. Avatar for felixxy 132. felixxy Lv 1 1 pt. 8,660
  3. Avatar for Squirrely 133. Squirrely Lv 1 1 pt. 8,660
  4. Avatar for Silvercraft 134. Silvercraft Lv 1 1 pt. 8,612
  5. Avatar for multaq 135. multaq Lv 1 1 pt. 8,557
  6. Avatar for Deleted player 136. Deleted player pts. 8,401
  7. Avatar for doctaven 137. doctaven Lv 1 1 pt. 8,365
  8. Avatar for katling 138. katling Lv 1 1 pt. 8,352
  9. Avatar for 01010011111 139. 01010011111 Lv 1 1 pt. 8,176
  10. Avatar for toshiue 140. toshiue Lv 1 1 pt. 6,488

Comments