Placeholder image of a protein
Icon representing a puzzle

1668: Revisiting Puzzle 134: Rice

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
April 29, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein shuttles lipids between cell membranes in the rice plant. The protein contains eight cysteines that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AGCNAGQLTVCTGAIAGGARPTAACCSSLRAQQGCFCQFAKDPRYGRYVNSPNARKAVSSCGIALPTCH

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,696
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,548
  3. Avatar for Gargleblasters 3. Gargleblasters 58 pts. 10,521
  4. Avatar for Go Science 4. Go Science 43 pts. 10,464
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 31 pts. 10,405
  6. Avatar for Marvin's bunch 6. Marvin's bunch 22 pts. 10,354
  7. Avatar for Russian team 7. Russian team 15 pts. 10,344
  8. Avatar for Contenders 8. Contenders 11 pts. 10,285
  9. Avatar for Void Crushers 9. Void Crushers 7 pts. 10,279
  10. Avatar for HMT heritage 10. HMT heritage 5 pts. 9,684
  1. Avatar for Cagdason 71. Cagdason Lv 1 6 pts. 9,192
  2. Avatar for Hellcat6 72. Hellcat6 Lv 1 6 pts. 9,114
  3. Avatar for dd-2 73. dd-2 Lv 1 6 pts. 9,112
  4. Avatar for abiogenesis 74. abiogenesis Lv 1 5 pts. 9,038
  5. Avatar for Auntecedent 75. Auntecedent Lv 1 5 pts. 8,913
  6. Avatar for Alistair69 76. Alistair69 Lv 1 5 pts. 8,906
  7. Avatar for benrh 77. benrh Lv 1 5 pts. 8,838
  8. Avatar for Pawel Tluscik 78. Pawel Tluscik Lv 1 4 pts. 8,800
  9. Avatar for JasperD 79. JasperD Lv 1 4 pts. 8,798
  10. Avatar for Silvercraft 80. Silvercraft Lv 1 4 pts. 8,729

Comments