Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,397
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,394
  3. Avatar for freefolder 13. freefolder 2 pts. 9,155
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,137
  5. Avatar for GENE 433 15. GENE 433 1 pt. 8,963
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,911
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,833
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 8,745
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 7,732
  10. Avatar for MBB190 20. MBB190 1 pt. 7,559
  1. Avatar for johnmitch 21. johnmitch Lv 1 52 pts. 9,585
  2. Avatar for silent gene 22. silent gene Lv 1 50 pts. 9,584
  3. Avatar for drumpeter18yrs9yrs 23. drumpeter18yrs9yrs Lv 1 49 pts. 9,583
  4. Avatar for crpainter 24. crpainter Lv 1 47 pts. 9,583
  5. Avatar for Deleted player 25. Deleted player pts. 9,581
  6. Avatar for vakobo 26. vakobo Lv 1 44 pts. 9,579
  7. Avatar for pvc78 27. pvc78 Lv 1 42 pts. 9,578
  8. Avatar for Threeoak 28. Threeoak Lv 1 41 pts. 9,574
  9. Avatar for Deleted player 29. Deleted player 39 pts. 9,554
  10. Avatar for guineapig 30. guineapig Lv 1 38 pts. 9,549

Comments