Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579
  1. Avatar for johnmitch 21. johnmitch Lv 1 52 pts. 9,585
  2. Avatar for silent gene 22. silent gene Lv 1 50 pts. 9,584
  3. Avatar for drumpeter18yrs9yrs 23. drumpeter18yrs9yrs Lv 1 49 pts. 9,583
  4. Avatar for crpainter 24. crpainter Lv 1 47 pts. 9,583
  5. Avatar for Deleted player 25. Deleted player pts. 9,581
  6. Avatar for vakobo 26. vakobo Lv 1 44 pts. 9,579
  7. Avatar for pvc78 27. pvc78 Lv 1 42 pts. 9,578
  8. Avatar for Threeoak 28. Threeoak Lv 1 41 pts. 9,574
  9. Avatar for Deleted player 29. Deleted player 39 pts. 9,554
  10. Avatar for guineapig 30. guineapig Lv 1 38 pts. 9,549

Comments