Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 4 pts. 9,397
  2. Avatar for Hold My Beer 12. Hold My Beer 3 pts. 9,394
  3. Avatar for freefolder 13. freefolder 2 pts. 9,155
  4. Avatar for DW 2020 14. DW 2020 1 pt. 9,137
  5. Avatar for GENE 433 15. GENE 433 1 pt. 8,963
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 8,911
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,833
  8. Avatar for I3L GANG 18. I3L GANG 1 pt. 8,745
  9. Avatar for Coastal Biochemistry 19. Coastal Biochemistry 1 pt. 7,732
  10. Avatar for MBB190 20. MBB190 1 pt. 7,559

  1. Avatar for fpc 41. fpc Lv 1 25 pts. 9,423
  2. Avatar for Deleted player 42. Deleted player pts. 9,423
  3. Avatar for Norrjane 43. Norrjane Lv 1 23 pts. 9,422
  4. Avatar for Vinara 44. Vinara Lv 1 22 pts. 9,401
  5. Avatar for andromeda72 45. andromeda72 Lv 1 21 pts. 9,397
  6. Avatar for Aminal88 46. Aminal88 Lv 1 20 pts. 9,394
  7. Avatar for rezaefar 47. rezaefar Lv 1 19 pts. 9,387
  8. Avatar for aznarog 48. aznarog Lv 1 19 pts. 9,378
  9. Avatar for tarimo 49. tarimo Lv 1 18 pts. 9,344
  10. Avatar for phi16 50. phi16 Lv 1 17 pts. 9,341

Comments