Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579
  1. Avatar for fpc 41. fpc Lv 1 25 pts. 9,423
  2. Avatar for Deleted player 42. Deleted player pts. 9,423
  3. Avatar for Norrjane 43. Norrjane Lv 1 23 pts. 9,422
  4. Avatar for Vinara 44. Vinara Lv 1 22 pts. 9,401
  5. Avatar for andromeda72 45. andromeda72 Lv 1 21 pts. 9,397
  6. Avatar for Aminal88 46. Aminal88 Lv 1 20 pts. 9,394
  7. Avatar for rezaefar 47. rezaefar Lv 1 19 pts. 9,387
  8. Avatar for aznarog 48. aznarog Lv 1 19 pts. 9,378
  9. Avatar for tarimo 49. tarimo Lv 1 18 pts. 9,344
  10. Avatar for phi16 50. phi16 Lv 1 17 pts. 9,341

Comments