Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Team South Africa 21. Team South Africa 1 pt. 7,293
  2. Avatar for NECC Anatomy and Physiology 22. NECC Anatomy and Physiology 1 pt. 5,351
  1. Avatar for multaq 121. multaq Lv 1 1 pt. 8,450
  2. Avatar for chloebborromeo 122. chloebborromeo Lv 1 1 pt. 8,446
  3. Avatar for joaniegirl 123. joaniegirl Lv 1 1 pt. 8,305
  4. Avatar for Maerlyn138 124. Maerlyn138 Lv 1 1 pt. 8,295
  5. Avatar for Deleted player 125. Deleted player pts. 8,279
  6. Avatar for leannerikicheever 126. leannerikicheever Lv 1 1 pt. 8,229
  7. Avatar for ehhan2018 127. ehhan2018 Lv 1 1 pt. 8,206
  8. Avatar for 181818 128. 181818 Lv 1 1 pt. 8,147
  9. Avatar for orily1337 129. orily1337 Lv 1 1 pt. 8,121
  10. Avatar for khendarg 130. khendarg Lv 1 1 pt. 8,102

Comments