Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579

  1. Avatar for multaq 121. multaq Lv 1 1 pt. 8,450
  2. Avatar for chloebborromeo 122. chloebborromeo Lv 1 1 pt. 8,446
  3. Avatar for joaniegirl 123. joaniegirl Lv 1 1 pt. 8,305
  4. Avatar for Maerlyn138 124. Maerlyn138 Lv 1 1 pt. 8,295
  5. Avatar for Deleted player 125. Deleted player pts. 8,279
  6. Avatar for leannerikicheever 126. leannerikicheever Lv 1 1 pt. 8,229
  7. Avatar for ehhan2018 127. ehhan2018 Lv 1 1 pt. 8,206
  8. Avatar for 181818 128. 181818 Lv 1 1 pt. 8,147
  9. Avatar for orily1337 129. orily1337 Lv 1 1 pt. 8,121
  10. Avatar for khendarg 130. khendarg Lv 1 1 pt. 8,102

Comments