Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579
  1. Avatar for aresescul 141. aresescul Lv 1 1 pt. 7,810
  2. Avatar for Deleted player 142. Deleted player 1 pt. 7,807
  3. Avatar for blee2 143. blee2 Lv 1 1 pt. 7,732
  4. Avatar for dvgf 144. dvgf Lv 1 1 pt. 7,725
  5. Avatar for bergie72 145. bergie72 Lv 1 1 pt. 7,724
  6. Avatar for bevans007 146. bevans007 Lv 1 1 pt. 7,721
  7. Avatar for Squidward Tortellini 147. Squidward Tortellini Lv 1 1 pt. 7,653
  8. Avatar for Kash Nirukhi 148. Kash Nirukhi Lv 1 1 pt. 7,600
  9. Avatar for throwing 149. throwing Lv 1 1 pt. 7,595
  10. Avatar for Elijah Flores 150. Elijah Flores Lv 1 1 pt. 7,559

Comments