Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579

  1. Avatar for JaimeTorres 151. JaimeTorres Lv 1 1 pt. 7,524
  2. Avatar for ScyllaHide 152. ScyllaHide Lv 1 1 pt. 7,479
  3. Avatar for rps29 153. rps29 Lv 1 1 pt. 7,433
  4. Avatar for rmoretti 154. rmoretti Lv 1 1 pt. 7,399
  5. Avatar for HouseM.D. 155. HouseM.D. Lv 1 1 pt. 7,332
  6. Avatar for doctaven 156. doctaven Lv 1 1 pt. 7,293
  7. Avatar for Bluriv 157. Bluriv Lv 1 1 pt. 7,241
  8. Avatar for Tehnologik1 158. Tehnologik1 Lv 1 1 pt. 6,913
  9. Avatar for 01010011111 159. 01010011111 Lv 1 1 pt. 6,472
  10. Avatar for JuAng2019 160. JuAng2019 Lv 1 1 pt. 5,351

Comments