Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since about 7 years ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups


  1. Avatar for Beta Folders 100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579

  1. Avatar for nicobul 11. nicobul Lv 1 73 pts. 9,656
  2. Avatar for frood66 12. frood66 Lv 1 71 pts. 9,654
  3. Avatar for Bruno Kestemont 13. Bruno Kestemont Lv 1 69 pts. 9,642
  4. Avatar for dcrwheeler 14. dcrwheeler Lv 1 66 pts. 9,633
  5. Avatar for Skippysk8s 15. Skippysk8s Lv 1 64 pts. 9,630
  6. Avatar for Flagg65a 16. Flagg65a Lv 1 62 pts. 9,618
  7. Avatar for O Seki To 17. O Seki To Lv 1 60 pts. 9,611
  8. Avatar for TastyMunchies 18. TastyMunchies Lv 1 58 pts. 9,600
  9. Avatar for jobo0502 19. jobo0502 Lv 1 56 pts. 9,598
  10. Avatar for Timo van der Laan 20. Timo van der Laan Lv 1 54 pts. 9,588

Comments