Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579
  1. Avatar for SiPot2018 71. SiPot2018 Lv 1 6 pts. 9,137
  2. Avatar for DoctorSockrates 72. DoctorSockrates Lv 1 6 pts. 9,121
  3. Avatar for alwen 73. alwen Lv 1 6 pts. 9,114
  4. Avatar for WBarme1234 74. WBarme1234 Lv 1 6 pts. 9,108
  5. Avatar for Squirrely 75. Squirrely Lv 1 5 pts. 9,104
  6. Avatar for dbuske 76. dbuske Lv 1 5 pts. 9,085
  7. Avatar for poiuytrewq987 77. poiuytrewq987 Lv 1 5 pts. 9,076
  8. Avatar for rabamino12358 78. rabamino12358 Lv 1 4 pts. 9,068
  9. Avatar for marsfan 79. marsfan Lv 1 4 pts. 9,067
  10. Avatar for jebbiek 80. jebbiek Lv 1 4 pts. 9,059

Comments