Placeholder image of a protein
Icon representing a puzzle

1671: Revisiting Puzzle 135: E. coli

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
May 07, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein comes from the bacteria Escherichia coli, but its function is still unknown! We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MGKATYTVTVTNNSNGVSVDYETETPMTLLVPEVAAEVIKDLVNTVRSYDTENEHDVCGW

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,807
  2. Avatar for Go Science 2. Go Science 79 pts. 9,775
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,718
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 47 pts. 9,700
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,690
  6. Avatar for Marvin's bunch 6. Marvin's bunch 26 pts. 9,654
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,611
  8. Avatar for Void Crushers 8. Void Crushers 14 pts. 9,588
  9. Avatar for Contenders 9. Contenders 10 pts. 9,583
  10. Avatar for Russian team 10. Russian team 7 pts. 9,579
  1. Avatar for Amphimixus 81. Amphimixus Lv 1 4 pts. 9,058
  2. Avatar for Silvercraft 82. Silvercraft Lv 1 4 pts. 9,029
  3. Avatar for pfirth 83. pfirth Lv 1 3 pts. 9,027
  4. Avatar for altejoh 84. altejoh Lv 1 3 pts. 9,016
  5. Avatar for stomjoh 85. stomjoh Lv 1 3 pts. 9,015
  6. Avatar for Lyshi2018 86. Lyshi2018 Lv 1 3 pts. 8,987
  7. Avatar for MrZanav 87. MrZanav Lv 1 3 pts. 8,982
  8. Avatar for Steven Pletsch 88. Steven Pletsch Lv 1 3 pts. 8,979
  9. Avatar for Simek 89. Simek Lv 1 2 pts. 8,966
  10. Avatar for Cagdason 90. Cagdason Lv 1 2 pts. 8,963

Comments