Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for FoldIt@Netherlands 11. FoldIt@Netherlands 1 pt. 9,650
  2. Avatar for Marvin's bunch 12. Marvin's bunch 1 pt. 9,589
  3. Avatar for GENE 433 13. GENE 433 1 pt. 9,280
  4. Avatar for freefolder 14. freefolder 1 pt. 9,161
  5. Avatar for I3L GANG 15. I3L GANG 1 pt. 7,252
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 6,567
  1. Avatar for nicobul 41. nicobul Lv 1 16 pts. 9,549
  2. Avatar for Aminal88 42. Aminal88 Lv 1 15 pts. 9,545
  3. Avatar for Phyx 43. Phyx Lv 1 14 pts. 9,526
  4. Avatar for jausmh 44. jausmh Lv 1 13 pts. 9,520
  5. Avatar for crpainter 45. crpainter Lv 1 13 pts. 9,517
  6. Avatar for heather-1 46. heather-1 Lv 1 12 pts. 9,507
  7. Avatar for tarimo 47. tarimo Lv 1 11 pts. 9,503
  8. Avatar for aznarog 48. aznarog Lv 1 11 pts. 9,478
  9. Avatar for johnmitch 49. johnmitch Lv 1 10 pts. 9,434
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 9 pts. 9,431

Comments