Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups


  1. Avatar for Gargleblasters 100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709

  1. Avatar for nicobul 41. nicobul Lv 1 16 pts. 9,549
  2. Avatar for Aminal88 42. Aminal88 Lv 1 15 pts. 9,545
  3. Avatar for Phyx 43. Phyx Lv 1 14 pts. 9,526
  4. Avatar for jausmh 44. jausmh Lv 1 13 pts. 9,520
  5. Avatar for crpainter 45. crpainter Lv 1 13 pts. 9,517
  6. Avatar for heather-1 46. heather-1 Lv 1 12 pts. 9,507
  7. Avatar for tarimo 47. tarimo Lv 1 11 pts. 9,503
  8. Avatar for aznarog 48. aznarog Lv 1 11 pts. 9,478
  9. Avatar for johnmitch 49. johnmitch Lv 1 10 pts. 9,434
  10. Avatar for WBarme1234 50. WBarme1234 Lv 1 9 pts. 9,431

Comments