Placeholder image of a protein
Icon representing a puzzle

1673: Unsolved De-novo Freestyle 152

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 14, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GVIIVWDKDLNIVIIVILDTQQVYVVHDEDEKVKEMRKKIEEVMRRSQDEEEIERQIWRLLEEMK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 10,168
  2. Avatar for Hold My Beer 2. Hold My Beer 71 pts. 9,987
  3. Avatar for Beta Folders 3. Beta Folders 49 pts. 9,960
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 33 pts. 9,958
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 22 pts. 9,929
  6. Avatar for Go Science 6. Go Science 14 pts. 9,909
  7. Avatar for Void Crushers 7. Void Crushers 8 pts. 9,831
  8. Avatar for Russian team 8. Russian team 5 pts. 9,749
  9. Avatar for HMT heritage 9. HMT heritage 3 pts. 9,723
  10. Avatar for Contenders 10. Contenders 2 pts. 9,709
  1. Avatar for grogar7 21. grogar7 Lv 1 43 pts. 9,734
  2. Avatar for smilingone 22. smilingone Lv 1 41 pts. 9,728
  3. Avatar for O Seki To 23. O Seki To Lv 1 39 pts. 9,723
  4. Avatar for spvincent 24. spvincent Lv 1 38 pts. 9,709
  5. Avatar for anthion 25. anthion Lv 1 36 pts. 9,703
  6. Avatar for Vinara 26. Vinara Lv 1 34 pts. 9,686
  7. Avatar for Tehnologik1 27. Tehnologik1 Lv 1 33 pts. 9,679
  8. Avatar for guineapig 28. guineapig Lv 1 31 pts. 9,675
  9. Avatar for hpaege 29. hpaege Lv 1 30 pts. 9,670
  10. Avatar for Anfinsen_slept_here 30. Anfinsen_slept_here Lv 1 28 pts. 9,665

Comments