Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for Reelix 121. Reelix Lv 1 1 pt. 4,987
  2. Avatar for Rayans124 122. Rayans124 Lv 1 1 pt. 4,786
  3. Avatar for dbuske 123. dbuske Lv 1 1 pt. 4,671
  4. Avatar for Biochemica 124. Biochemica Lv 1 1 pt. 4,616
  5. Avatar for lamoille 125. lamoille Lv 1 1 pt. 0
  6. Avatar for Cloth Folder 528 126. Cloth Folder 528 Lv 1 1 pt. 0
  7. Avatar for Alistair69 127. Alistair69 Lv 1 1 pt. 0
  8. Avatar for DodoBird 128. DodoBird Lv 1 1 pt. 0
  9. Avatar for tyler0911 129. tyler0911 Lv 1 1 pt. 0
  10. Avatar for Susume 130. Susume Lv 1 1 pt. 0

Comments