Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for Steven Pletsch 31. Steven Pletsch Lv 1 27 pts. 9,691
  2. Avatar for Marvelz 32. Marvelz Lv 1 26 pts. 9,691
  3. Avatar for aznarog 33. aznarog Lv 1 25 pts. 9,682
  4. Avatar for dcrwheeler 34. dcrwheeler Lv 1 24 pts. 9,667
  5. Avatar for robgee 35. robgee Lv 1 22 pts. 9,641
  6. Avatar for MicElephant 36. MicElephant Lv 1 21 pts. 9,636
  7. Avatar for smilingone 37. smilingone Lv 1 20 pts. 9,635
  8. Avatar for cbwest 38. cbwest Lv 1 19 pts. 9,634
  9. Avatar for Phyx 39. Phyx Lv 1 18 pts. 9,633
  10. Avatar for joremen 40. joremen Lv 1 17 pts. 9,629

Comments