Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for TastyMunchies 51. TastyMunchies Lv 1 9 pts. 9,478
  2. Avatar for RestrictionEndoNykolease 52. RestrictionEndoNykolease Lv 1 9 pts. 9,472
  3. Avatar for stomjoh 53. stomjoh Lv 1 8 pts. 9,453
  4. Avatar for heather-1 54. heather-1 Lv 1 8 pts. 9,448
  5. Avatar for WBarme1234 55. WBarme1234 Lv 1 7 pts. 9,446
  6. Avatar for jausmh 56. jausmh Lv 1 7 pts. 9,430
  7. Avatar for orily1337 57. orily1337 Lv 1 6 pts. 9,416
  8. Avatar for benrh 58. benrh Lv 1 6 pts. 9,399
  9. Avatar for NinjaGreg 59. NinjaGreg Lv 1 6 pts. 9,386
  10. Avatar for phi16 60. phi16 Lv 1 5 pts. 9,348

Comments