Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for Hellcat6 61. Hellcat6 Lv 1 5 pts. 9,320
  2. Avatar for Bautho 62. Bautho Lv 1 5 pts. 9,318
  3. Avatar for Squirrely 63. Squirrely Lv 1 4 pts. 9,285
  4. Avatar for mitarcher 64. mitarcher Lv 1 4 pts. 9,272
  5. Avatar for alwen 65. alwen Lv 1 4 pts. 9,266
  6. Avatar for alcor29 66. alcor29 Lv 1 4 pts. 9,260
  7. Avatar for harvardman 67. harvardman Lv 1 3 pts. 9,256
  8. Avatar for Vmou 68. Vmou Lv 1 3 pts. 9,242
  9. Avatar for rwillett 69. rwillett Lv 1 3 pts. 9,234
  10. Avatar for drumpeter18yrs9yrs 70. drumpeter18yrs9yrs Lv 1 3 pts. 9,217

Comments