Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for boondog 71. boondog Lv 1 3 pts. 9,210
  2. Avatar for Deleted player 72. Deleted player 2 pts. 9,205
  3. Avatar for spvincent 73. spvincent Lv 1 2 pts. 9,198
  4. Avatar for abiogenesis 74. abiogenesis Lv 1 2 pts. 9,167
  5. Avatar for Arne Heessels 75. Arne Heessels Lv 1 2 pts. 9,152
  6. Avatar for fpc 76. fpc Lv 1 2 pts. 9,150
  7. Avatar for felixxy 77. felixxy Lv 1 2 pts. 9,112
  8. Avatar for Pawel Tluscik 78. Pawel Tluscik Lv 1 2 pts. 9,066
  9. Avatar for Flagg65a 79. Flagg65a Lv 1 2 pts. 9,059
  10. Avatar for rol 80. rol Lv 1 1 pt. 9,034

Comments