Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Hold My Beer 11. Hold My Beer 1 pt. 9,691
  2. Avatar for freefolder 12. freefolder 1 pt. 9,437
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 8,712
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,710
  1. Avatar for jamiexq 81. jamiexq Lv 1 1 pt. 9,022
  2. Avatar for navn 82. navn Lv 1 1 pt. 9,002
  3. Avatar for dd-2 83. dd-2 Lv 1 1 pt. 8,961
  4. Avatar for thewholeblahthing 84. thewholeblahthing Lv 1 1 pt. 8,944
  5. Avatar for ManVsYard 85. ManVsYard Lv 1 1 pt. 8,908
  6. Avatar for Knoblerine 86. Knoblerine Lv 1 1 pt. 8,869
  7. Avatar for Psych0Active 87. Psych0Active Lv 1 1 pt. 8,862
  8. Avatar for Tehnologik1 88. Tehnologik1 Lv 1 1 pt. 8,827
  9. Avatar for toshiue 89. toshiue Lv 1 1 pt. 8,824
  10. Avatar for rinze 90. rinze Lv 1 1 pt. 8,808

Comments