Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710

  1. Avatar for multaq 91. multaq Lv 1 1 pt. 8,798
  2. Avatar for 15SecNut 92. 15SecNut Lv 1 1 pt. 8,774
  3. Avatar for JasperD 93. JasperD Lv 1 1 pt. 8,712
  4. Avatar for zanbato 94. zanbato Lv 1 1 pt. 8,710
  5. Avatar for rezaefar 95. rezaefar Lv 1 1 pt. 8,697
  6. Avatar for rabamino12358 96. rabamino12358 Lv 1 1 pt. 8,691
  7. Avatar for pfirth 97. pfirth Lv 1 1 pt. 8,676
  8. Avatar for Willyanto 98. Willyanto Lv 1 1 pt. 8,519
  9. Avatar for Merf 99. Merf Lv 1 1 pt. 8,430
  10. Avatar for NinguLilium 100. NinguLilium Lv 1 1 pt. 8,413

Comments