Placeholder image of a protein
Icon representing a puzzle

1679: Unsolved De-novo Freestyle 153

Closed since almost 7 years ago

Intermediate Overall Prediction

Summary

Created
May 23, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

DDREYEEQIRRKLKRGETSIVSSDGVYIVVQDGDVIVLINGKMEEYRNLDEEQIIRLILEIMKKQ

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,376
  2. Avatar for Gargleblasters 2. Gargleblasters 68 pts. 10,328
  3. Avatar for Beta Folders 3. Beta Folders 44 pts. 10,080
  4. Avatar for Go Science 4. Go Science 27 pts. 10,047
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 9,993
  6. Avatar for Void Crushers 6. Void Crushers 9 pts. 9,900
  7. Avatar for Contenders 7. Contenders 5 pts. 9,839
  8. Avatar for Marvin's bunch 8. Marvin's bunch 3 pts. 9,784
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 9,765
  10. Avatar for Russian team 10. Russian team 1 pt. 9,710
  1. Avatar for JugrenisII 101. JugrenisII Lv 1 1 pt. 8,357
  2. Avatar for asd456 102. asd456 Lv 1 1 pt. 8,317
  3. Avatar for petetrig 103. petetrig Lv 1 1 pt. 8,260
  4. Avatar for otong1 104. otong1 Lv 1 1 pt. 8,245
  5. Avatar for Dantoto 105. Dantoto Lv 1 1 pt. 8,143
  6. Avatar for hajtogato 106. hajtogato Lv 1 1 pt. 8,136
  7. Avatar for Undefined24 107. Undefined24 Lv 1 1 pt. 8,126
  8. Avatar for Eloy_Beltran 108. Eloy_Beltran Lv 1 1 pt. 7,953
  9. Avatar for Greenlee 109. Greenlee Lv 1 1 pt. 7,919
  10. Avatar for lconor 110. lconor Lv 1 1 pt. 7,727

Comments