Placeholder image of a protein
Icon representing a puzzle

1682: Revisiting Puzzle 52: Bacterial Energy

Closed since almost 7 years ago

Novice Overall Prediction

Summary

Created
June 04, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is part of a metabolic pathway used by bacteria to harvest energy from sugars. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KKHIYLFSSAGMSTSLLVSKMRAQAEKYEVPVIIEAFPETLAGEKGQNADVVLLGPQIAYMLPEIQRLLPNKPVEVIDSLLYGKVDGLGVLKAAVAAIKKAAA

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,528
  2. Avatar for Beta Folders 2. Beta Folders 70 pts. 11,515
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 11,490
  4. Avatar for Marvin's bunch 4. Marvin's bunch 30 pts. 11,437
  5. Avatar for HMT heritage 5. HMT heritage 19 pts. 11,417
  6. Avatar for Void Crushers 6. Void Crushers 11 pts. 11,411
  7. Avatar for Russian team 7. Russian team 7 pts. 11,311
  8. Avatar for Contenders 8. Contenders 4 pts. 11,264
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 11,254
  10. Avatar for Gargleblasters 10. Gargleblasters 1 pt. 11,244
  1. Avatar for dd-2 91. dd-2 Lv 1 2 pts. 10,257
  2. Avatar for lightsing 92. lightsing Lv 1 2 pts. 10,251
  3. Avatar for Vincera 93. Vincera Lv 1 2 pts. 10,243
  4. Avatar for b3nc33 94. b3nc33 Lv 1 1 pt. 10,221
  5. Avatar for sim4ones 95. sim4ones Lv 1 1 pt. 10,214
  6. Avatar for ti_go_Mars 96. ti_go_Mars Lv 1 1 pt. 10,202
  7. Avatar for Dantoto 97. Dantoto Lv 1 1 pt. 10,196
  8. Avatar for zsumierp 98. zsumierp Lv 1 1 pt. 10,142
  9. Avatar for dbuske 99. dbuske Lv 1 1 pt. 10,138
  10. Avatar for xbp 100. xbp Lv 1 1 pt. 10,097

Comments