Placeholder image of a protein
Icon representing a puzzle

1687: Revisiting Puzzle 55: Scorpion Toxin

Closed since over 6 years ago

Novice Overall Prediction

Summary


Created
June 14, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin binds to voltage-gated ion channels in insects, resulting in full-body paralysis. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


VKDGYIVDDVNCTYFCGRNAYCNEECTKLKGESGYCQWASPYGNACYCYKLPDHVRTKGPGRCH

Top groups


  1. Avatar for BOINC@Poland 11. BOINC@Poland 1 pt. 9,575
  2. Avatar for FoldIt@Netherlands 12. FoldIt@Netherlands 1 pt. 9,135
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,796
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,478
  5. Avatar for Hold My Beer 15. Hold My Beer 1 pt. 8,369
  6. Avatar for I3L GANG 16. I3L GANG 1 pt. 7,432
  7. Avatar for Window Group 17. Window Group 1 pt. 4,813

  1. Avatar for jausmh 51. jausmh Lv 1 10 pts. 9,718
  2. Avatar for drumpeter18yrs9yrs 52. drumpeter18yrs9yrs Lv 1 9 pts. 9,624
  3. Avatar for benrh 53. benrh Lv 1 9 pts. 9,586
  4. Avatar for kitek314_pl 54. kitek314_pl Lv 1 8 pts. 9,575
  5. Avatar for cbwest 56. cbwest Lv 1 7 pts. 9,474
  6. Avatar for DoctorSockrates 57. DoctorSockrates Lv 1 7 pts. 9,458
  7. Avatar for georg137 58. georg137 Lv 1 6 pts. 9,443
  8. Avatar for Deleted player 59. Deleted player pts. 9,438
  9. Avatar for drjr 60. drjr Lv 1 6 pts. 9,417

Comments