Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 6 years ago

Intermediate Overall Prediction

Summary


Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups


  1. Avatar for Beta Folders 100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994

  1. Avatar for O Seki To 31. O Seki To Lv 1 28 pts. 10,132
  2. Avatar for Norrjane 32. Norrjane Lv 1 26 pts. 10,128
  3. Avatar for christioanchauvin 33. christioanchauvin Lv 1 25 pts. 10,116
  4. Avatar for Vinara 34. Vinara Lv 1 24 pts. 10,097
  5. Avatar for guineapig 35. guineapig Lv 1 23 pts. 10,093
  6. Avatar for Blipperman 36. Blipperman Lv 1 22 pts. 10,091
  7. Avatar for DoctorSockrates 37. DoctorSockrates Lv 1 21 pts. 10,074
  8. Avatar for YeshuaLives 38. YeshuaLives Lv 1 20 pts. 10,071
  9. Avatar for Hellcat6 39. Hellcat6 Lv 1 19 pts. 10,038
  10. Avatar for Flagg65a 40. Flagg65a Lv 1 18 pts. 10,037

Comments