Placeholder image of a protein
Icon representing a puzzle

1690: Revisiting Puzzle 57: Beta-Neurotoxin

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 24, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This scorpion toxin is similar to the one from Puzzle 55, and binds to voltage-gated ion channels of insects. The protein contains eight cysteine residues that oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


KDGYLVEKTGCKKTCYKLGENDFCNRECKWKHIGGSYGYCYGFGCYCEGLPDSTQTWPLPNKTC

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,555
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 68 pts. 10,508
  3. Avatar for Gargleblasters 3. Gargleblasters 44 pts. 10,505
  4. Avatar for Marvin's bunch 4. Marvin's bunch 27 pts. 10,501
  5. Avatar for Go Science 5. Go Science 16 pts. 10,444
  6. Avatar for L'Alliance Francophone 6. L'Alliance Francophone 9 pts. 10,411
  7. Avatar for Contenders 7. Contenders 5 pts. 10,335
  8. Avatar for Void Crushers 8. Void Crushers 3 pts. 10,239
  9. Avatar for HMT heritage 9. HMT heritage 1 pt. 10,132
  10. Avatar for Russian team 10. Russian team 1 pt. 9,994
  1. Avatar for phi16 21. phi16 Lv 1 44 pts. 10,217
  2. Avatar for anthion 22. anthion Lv 1 42 pts. 10,210
  3. Avatar for georg137 23. georg137 Lv 1 40 pts. 10,201
  4. Avatar for dcrwheeler 24. dcrwheeler Lv 1 39 pts. 10,200
  5. Avatar for Phyx 25. Phyx Lv 1 37 pts. 10,186
  6. Avatar for Deleted player 26. Deleted player pts. 10,174
  7. Avatar for joremen 27. joremen Lv 1 34 pts. 10,173
  8. Avatar for Idiotboy 28. Idiotboy Lv 1 32 pts. 10,154
  9. Avatar for alwen 29. alwen Lv 1 31 pts. 10,150
  10. Avatar for diamonddays 30. diamonddays Lv 1 29 pts. 10,145

Comments