Placeholder image of a protein
Icon representing a puzzle

1691: Unsolved De-novo Freestyle 154

Closed since over 6 years ago

Intermediate Overall Prediction

Summary

Created
June 25, 2019
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:

GSREELLDRLDEILDEADKIIERANEALKEKDDKSKYQKLLKEHEEAVDKLLKIAEKHREMG

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,023
  2. Avatar for Go Science 2. Go Science 70 pts. 9,985
  3. Avatar for Gargleblasters 3. Gargleblasters 47 pts. 9,928
  4. Avatar for Beta Folders 4. Beta Folders 30 pts. 9,878
  5. Avatar for Contenders 5. Contenders 19 pts. 9,867
  6. Avatar for Russian team 6. Russian team 11 pts. 9,856
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 7 pts. 9,849
  8. Avatar for Hold My Beer 8. Hold My Beer 4 pts. 9,824
  9. Avatar for Marvin's bunch 9. Marvin's bunch 2 pts. 9,756
  10. Avatar for Void Crushers 10. Void Crushers 1 pt. 9,736
  1. Avatar for Marvelz 71. Marvelz Lv 1 2 pts. 9,336
  2. Avatar for Origami314 72. Origami314 Lv 1 2 pts. 9,330
  3. Avatar for Flagg65a 73. Flagg65a Lv 1 2 pts. 9,327
  4. Avatar for xbp 74. xbp Lv 1 1 pt. 9,314
  5. Avatar for Divisor11 75. Divisor11 Lv 1 1 pt. 9,296
  6. Avatar for cbwest 76. cbwest Lv 1 1 pt. 9,293
  7. Avatar for alcor29 77. alcor29 Lv 1 1 pt. 9,288
  8. Avatar for hajtogato 78. hajtogato Lv 1 1 pt. 9,264
  9. Avatar for donuts554 79. donuts554 Lv 1 1 pt. 9,244
  10. Avatar for 15SecNut 80. 15SecNut Lv 1 1 pt. 9,238

Comments