Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for Puttering 101. Puttering Lv 1 1 pt. 8,485
  2. Avatar for BPS_IORIO_2019 102. BPS_IORIO_2019 Lv 1 1 pt. 8,449
  3. Avatar for 4rt3m1s 103. 4rt3m1s Lv 1 1 pt. 8,420
  4. Avatar for jmb23 104. jmb23 Lv 1 1 pt. 8,292
  5. Avatar for fungko 105. fungko Lv 1 1 pt. 8,232
  6. Avatar for kisurb 106. kisurb Lv 1 1 pt. 8,177
  7. Avatar for RockOn 107. RockOn Lv 1 1 pt. 8,039
  8. Avatar for Artistic Scientist 108. Artistic Scientist Lv 1 1 pt. 7,936
  9. Avatar for Frank.wu 109. Frank.wu Lv 1 1 pt. 7,921
  10. Avatar for jausmh 110. jausmh Lv 1 1 pt. 7,911

Comments