Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for Puttering 101. Puttering Lv 1 1 pt. 8,485
  2. Avatar for BPS_IORIO_2019 102. BPS_IORIO_2019 Lv 1 1 pt. 8,449
  3. Avatar for 4rt3m1s 103. 4rt3m1s Lv 1 1 pt. 8,420
  4. Avatar for jmb23 104. jmb23 Lv 1 1 pt. 8,292
  5. Avatar for fungko 105. fungko Lv 1 1 pt. 8,232
  6. Avatar for kisurb 106. kisurb Lv 1 1 pt. 8,177
  7. Avatar for RockOn 107. RockOn Lv 1 1 pt. 8,039
  8. Avatar for Artistic Scientist 108. Artistic Scientist Lv 1 1 pt. 7,936
  9. Avatar for Frank.wu 109. Frank.wu Lv 1 1 pt. 7,921
  10. Avatar for jausmh 110. jausmh Lv 1 1 pt. 7,911

Comments