Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 64 pts. 10,042
  2. Avatar for vakobo 12. vakobo Lv 1 61 pts. 10,037
  3. Avatar for frood66 13. frood66 Lv 1 58 pts. 10,021
  4. Avatar for jobo0502 14. jobo0502 Lv 1 55 pts. 10,011
  5. Avatar for jermainiac 15. jermainiac Lv 1 53 pts. 9,992
  6. Avatar for actiasluna 16. actiasluna Lv 1 50 pts. 9,990
  7. Avatar for Galaxie 17. Galaxie Lv 1 48 pts. 9,985
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 45 pts. 9,966
  9. Avatar for georg137 19. georg137 Lv 1 43 pts. 9,954
  10. Avatar for Deleted player 20. Deleted player pts. 9,945

Comments