Foldit

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created: July 08, 2019
Expires: July 15, 2019 at 18:00 UTC
Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence:

DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT