Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for NinjaGreg 11. NinjaGreg Lv 1 64 pts. 10,042
  2. Avatar for vakobo 12. vakobo Lv 1 61 pts. 10,037
  3. Avatar for frood66 13. frood66 Lv 1 58 pts. 10,021
  4. Avatar for jobo0502 14. jobo0502 Lv 1 55 pts. 10,011
  5. Avatar for jermainiac 15. jermainiac Lv 1 53 pts. 9,992
  6. Avatar for actiasluna 16. actiasluna Lv 1 50 pts. 9,990
  7. Avatar for Galaxie 17. Galaxie Lv 1 48 pts. 9,985
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 45 pts. 9,966
  9. Avatar for georg137 19. georg137 Lv 1 43 pts. 9,954
  10. Avatar for Deleted player 20. Deleted player pts. 9,945

Comments