Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for silent gene 21. silent gene Lv 1 39 pts. 9,943
  2. Avatar for johnmitch 22. johnmitch Lv 1 37 pts. 9,942
  3. Avatar for guineapig 23. guineapig Lv 1 35 pts. 9,927
  4. Avatar for Blipperman 24. Blipperman Lv 1 33 pts. 9,926
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 32 pts. 9,919
  6. Avatar for pvc78 26. pvc78 Lv 1 30 pts. 9,862
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 28 pts. 9,853
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 27 pts. 9,840
  9. Avatar for TastyMunchies 29. TastyMunchies Lv 1 25 pts. 9,798
  10. Avatar for Vinara 30. Vinara Lv 1 24 pts. 9,783

Comments