Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 7 years ago

Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457

  1. Avatar for silent gene 21. silent gene Lv 1 39 pts. 9,943
  2. Avatar for johnmitch 22. johnmitch Lv 1 37 pts. 9,942
  3. Avatar for guineapig 23. guineapig Lv 1 35 pts. 9,927
  4. Avatar for Blipperman 24. Blipperman Lv 1 33 pts. 9,926
  5. Avatar for WBarme1234 25. WBarme1234 Lv 1 32 pts. 9,919
  6. Avatar for pvc78 26. pvc78 Lv 1 30 pts. 9,862
  7. Avatar for DoctorSockrates 27. DoctorSockrates Lv 1 28 pts. 9,853
  8. Avatar for christioanchauvin 28. christioanchauvin Lv 1 27 pts. 9,840
  9. Avatar for TastyMunchies 29. TastyMunchies Lv 1 25 pts. 9,798
  10. Avatar for Vinara 30. Vinara Lv 1 24 pts. 9,783

Comments