Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for Deleted player 41. Deleted player pts. 9,640
  2. Avatar for cbwest 42. cbwest Lv 1 12 pts. 9,634
  3. Avatar for kludbrook 43. kludbrook Lv 1 11 pts. 9,621
  4. Avatar for alcor29 44. alcor29 Lv 1 10 pts. 9,612
  5. Avatar for toshiue 45. toshiue Lv 1 9 pts. 9,603
  6. Avatar for Deleted player 46. Deleted player 9 pts. 9,581
  7. Avatar for stomjoh 47. stomjoh Lv 1 8 pts. 9,576
  8. Avatar for joremen 48. joremen Lv 1 8 pts. 9,572
  9. Avatar for Alistair69 49. Alistair69 Lv 1 7 pts. 9,571
  10. Avatar for heather-1 50. heather-1 Lv 1 7 pts. 9,539

Comments