Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for Deleted player 41. Deleted player pts. 9,640
  2. Avatar for cbwest 42. cbwest Lv 1 12 pts. 9,634
  3. Avatar for kludbrook 43. kludbrook Lv 1 11 pts. 9,621
  4. Avatar for alcor29 44. alcor29 Lv 1 10 pts. 9,612
  5. Avatar for toshiue 45. toshiue Lv 1 9 pts. 9,603
  6. Avatar for Deleted player 46. Deleted player 9 pts. 9,581
  7. Avatar for stomjoh 47. stomjoh Lv 1 8 pts. 9,576
  8. Avatar for joremen 48. joremen Lv 1 8 pts. 9,572
  9. Avatar for Alistair69 49. Alistair69 Lv 1 7 pts. 9,571
  10. Avatar for heather-1 50. heather-1 Lv 1 7 pts. 9,539

Comments