Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for aznarog 51. aznarog Lv 1 6 pts. 9,509
  2. Avatar for Aminal88 52. Aminal88 Lv 1 6 pts. 9,457
  3. Avatar for Cloudy101 53. Cloudy101 Lv 1 5 pts. 9,456
  4. Avatar for Keresto 54. Keresto Lv 1 5 pts. 9,444
  5. Avatar for joaniegirl 55. joaniegirl Lv 1 5 pts. 9,420
  6. Avatar for alyssa_d 56. alyssa_d Lv 1 4 pts. 9,418
  7. Avatar for Flagg65a 57. Flagg65a Lv 1 4 pts. 9,394
  8. Avatar for fpc 58. fpc Lv 1 4 pts. 9,331
  9. Avatar for ppp6 59. ppp6 Lv 1 3 pts. 9,258
  10. Avatar for Steven Pletsch 60. Steven Pletsch Lv 1 3 pts. 9,252

Comments