Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for aznarog 51. aznarog Lv 1 6 pts. 9,509
  2. Avatar for Aminal88 52. Aminal88 Lv 1 6 pts. 9,457
  3. Avatar for Cloudy101 53. Cloudy101 Lv 1 5 pts. 9,456
  4. Avatar for Keresto 54. Keresto Lv 1 5 pts. 9,444
  5. Avatar for joaniegirl 55. joaniegirl Lv 1 5 pts. 9,420
  6. Avatar for alyssa_d 56. alyssa_d Lv 1 4 pts. 9,418
  7. Avatar for Flagg65a 57. Flagg65a Lv 1 4 pts. 9,394
  8. Avatar for fpc 58. fpc Lv 1 4 pts. 9,331
  9. Avatar for ppp6 59. ppp6 Lv 1 3 pts. 9,258
  10. Avatar for Steven Pletsch 60. Steven Pletsch Lv 1 3 pts. 9,252

Comments