Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for lconor 61. lconor Lv 1 3 pts. 9,252
  2. Avatar for kentish_alex 62. kentish_alex Lv 1 3 pts. 9,246
  3. Avatar for rezaefar 63. rezaefar Lv 1 3 pts. 9,244
  4. Avatar for abiogenesis 64. abiogenesis Lv 1 2 pts. 9,185
  5. Avatar for cobaltteal 65. cobaltteal Lv 1 2 pts. 9,125
  6. Avatar for Pawel Tluscik 66. Pawel Tluscik Lv 1 2 pts. 9,100
  7. Avatar for Altercomp 67. Altercomp Lv 1 2 pts. 9,078
  8. Avatar for 181818 68. 181818 Lv 1 2 pts. 9,047
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 2 pts. 9,036
  10. Avatar for aspadistra 70. aspadistra Lv 1 2 pts. 9,035

Comments