Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457
  1. Avatar for lconor 61. lconor Lv 1 3 pts. 9,252
  2. Avatar for kentish_alex 62. kentish_alex Lv 1 3 pts. 9,246
  3. Avatar for rezaefar 63. rezaefar Lv 1 3 pts. 9,244
  4. Avatar for abiogenesis 64. abiogenesis Lv 1 2 pts. 9,185
  5. Avatar for cobaltteal 65. cobaltteal Lv 1 2 pts. 9,125
  6. Avatar for Pawel Tluscik 66. Pawel Tluscik Lv 1 2 pts. 9,100
  7. Avatar for Altercomp 67. Altercomp Lv 1 2 pts. 9,078
  8. Avatar for 181818 68. 181818 Lv 1 2 pts. 9,047
  9. Avatar for kitek314_pl 69. kitek314_pl Lv 1 2 pts. 9,036
  10. Avatar for aspadistra 70. aspadistra Lv 1 2 pts. 9,035

Comments