Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups

  1. Avatar for The Daydreamers 11. The Daydreamers 1 pt. 9,456
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,418
  3. Avatar for BOINC@Poland 13. BOINC@Poland 1 pt. 9,036
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 9,035
  5. Avatar for FoldIt@Netherlands 15. FoldIt@Netherlands 1 pt. 8,953
  6. Avatar for Proteinchemie 16. Proteinchemie 1 pt. 3,611
  1. Avatar for dd-2 81. dd-2 Lv 1 1 pt. 8,891
  2. Avatar for Vojtenzi CZE 82. Vojtenzi CZE Lv 1 1 pt. 8,876
  3. Avatar for Arne Heessels 83. Arne Heessels Lv 1 1 pt. 8,874
  4. Avatar for pandapharmd 84. pandapharmd Lv 1 1 pt. 8,866
  5. Avatar for GO_GO_GO_GO_GO 85. GO_GO_GO_GO_GO Lv 1 1 pt. 8,839
  6. Avatar for hada 86. hada Lv 1 1 pt. 8,835
  7. Avatar for Squirrely 87. Squirrely Lv 1 1 pt. 8,826
  8. Avatar for ScyllaHide 88. ScyllaHide Lv 1 1 pt. 8,812
  9. Avatar for xbp 89. xbp Lv 1 1 pt. 8,811
  10. Avatar for drumpeter18yrs9yrs 90. drumpeter18yrs9yrs Lv 1 1 pt. 8,787

Comments