Placeholder image of a protein
Icon representing a puzzle

1696: Revisiting Puzzle 59: TCR Binding Protein

Closed since almost 7 years ago

Novice Novice Novice Novice Overall Overall Overall Overall Prediction Prediction Prediction Prediction

Summary


Created
July 08, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small, intracellular domain binds to the CD2 T cell receptor (TCR), and plays a critical role in T cell activation during the immune response. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


DVMWEYKWENTGDAELYGPFTSAQMQTWVSEGYFPDGVYCRKLDPPGGQFYNSKRIDFDLYT

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,137
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 71 pts. 10,100
  3. Avatar for Go Science 3. Go Science 49 pts. 10,088
  4. Avatar for Gargleblasters 4. Gargleblasters 33 pts. 10,086
  5. Avatar for HMT heritage 5. HMT heritage 22 pts. 10,085
  6. Avatar for Beta Folders 6. Beta Folders 14 pts. 10,085
  7. Avatar for Marvin's bunch 7. Marvin's bunch 8 pts. 10,047
  8. Avatar for Contenders 8. Contenders 5 pts. 10,045
  9. Avatar for Russian team 9. Russian team 3 pts. 10,037
  10. Avatar for Hold My Beer 10. Hold My Beer 2 pts. 9,457

  1. Avatar for dd-2 81. dd-2 Lv 1 1 pt. 8,891
  2. Avatar for Vojtenzi CZE 82. Vojtenzi CZE Lv 1 1 pt. 8,876
  3. Avatar for Arne Heessels 83. Arne Heessels Lv 1 1 pt. 8,874
  4. Avatar for pandapharmd 84. pandapharmd Lv 1 1 pt. 8,866
  5. Avatar for GO_GO_GO_GO_GO 85. GO_GO_GO_GO_GO Lv 1 1 pt. 8,839
  6. Avatar for hada 86. hada Lv 1 1 pt. 8,835
  7. Avatar for Squirrely 87. Squirrely Lv 1 1 pt. 8,826
  8. Avatar for ScyllaHide 88. ScyllaHide Lv 1 1 pt. 8,812
  9. Avatar for xbp 89. xbp Lv 1 1 pt. 8,811

Comments