Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Novice Overall Overall Prediction Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,729
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,661
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 11,424
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 11,251
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 11,218
  6. Avatar for GUGITBIOTECH 16. GUGITBIOTECH 1 pt. 10,973
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,176
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 10,009
  9. Avatar for Deleted group 19. Deleted group pts. 4,514
  1. Avatar for Squirrely 101. Squirrely Lv 1 1 pt. 10,826
  2. Avatar for bmate 102. bmate Lv 1 1 pt. 10,769
  3. Avatar for Justin Won 103. Justin Won Lv 1 1 pt. 10,766
  4. Avatar for hajtogato 104. hajtogato Lv 1 1 pt. 10,763
  5. Avatar for pfirth 105. pfirth Lv 1 1 pt. 10,756
  6. Avatar for DipsyDoodle2016 106. DipsyDoodle2016 Lv 1 1 pt. 10,751
  7. Avatar for Dean Oh 107. Dean Oh Lv 1 1 pt. 10,744
  8. Avatar for GUANINJIN 108. GUANINJIN Lv 1 1 pt. 10,742
  9. Avatar for 181818 109. 181818 Lv 1 1 pt. 10,737
  10. Avatar for toshiue 110. toshiue Lv 1 1 pt. 10,728

Comments