Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 12,789
  2. Avatar for Beta Folders 2. Beta Folders 76 pts. 12,695
  3. Avatar for L'Alliance Francophone 3. L'Alliance Francophone 56 pts. 12,574
  4. Avatar for Marvin's bunch 4. Marvin's bunch 41 pts. 12,556
  5. Avatar for Go Science 5. Go Science 29 pts. 12,460
  6. Avatar for Contenders 6. Contenders 20 pts. 12,414
  7. Avatar for Gargleblasters 7. Gargleblasters 14 pts. 12,381
  8. Avatar for Russian team 8. Russian team 9 pts. 12,197
  9. Avatar for HMT heritage 9. HMT heritage 6 pts. 12,051
  10. Avatar for Hold My Beer 10. Hold My Beer 4 pts. 11,905
  1. Avatar for Squirrely 101. Squirrely Lv 1 1 pt. 10,826
  2. Avatar for bmate 102. bmate Lv 1 1 pt. 10,769
  3. Avatar for Justin Won 103. Justin Won Lv 1 1 pt. 10,766
  4. Avatar for hajtogato 104. hajtogato Lv 1 1 pt. 10,763
  5. Avatar for pfirth 105. pfirth Lv 1 1 pt. 10,756
  6. Avatar for DipsyDoodle2016 106. DipsyDoodle2016 Lv 1 1 pt. 10,751
  7. Avatar for Dean Oh 107. Dean Oh Lv 1 1 pt. 10,744
  8. Avatar for GUANINJIN 108. GUANINJIN Lv 1 1 pt. 10,742
  9. Avatar for 181818 109. 181818 Lv 1 1 pt. 10,737
  10. Avatar for toshiue 110. toshiue Lv 1 1 pt. 10,728

Comments