Placeholder image of a protein
Icon representing a puzzle

1699: Revisiting Puzzle 60: Beta Barrel

Closed since over 6 years ago

Novice Overall Prediction

Summary

Created
July 15, 2019
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds fatty acids in intestinal cells. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFDGTWKVDRNENYEKFMEKMGINVVKRKLGAHDNLKLTITQEGNKFTVKESSNFRNIDNVFELGVDFAYSLADGTELTGTWTMEGNKLVGKFKRVDNGKELIAVREISGNELIQTYTYEGVEAKRIFKKE

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 2 pts. 11,729
  2. Avatar for The Daydreamers 12. The Daydreamers 1 pt. 11,661
  3. Avatar for FoldIt@Netherlands 13. FoldIt@Netherlands 1 pt. 11,424
  4. Avatar for Trinity Biology 14. Trinity Biology 1 pt. 11,251
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 11,218
  6. Avatar for GUGITBIOTECH 16. GUGITBIOTECH 1 pt. 10,973
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 10,176
  8. Avatar for QCNMIT 18. QCNMIT 1 pt. 10,009
  9. Avatar for Deleted group 19. Deleted group pts. 4,514
  1. Avatar for phi16 11. phi16 Lv 1 68 pts. 12,401
  2. Avatar for johnmitch 12. johnmitch Lv 1 65 pts. 12,392
  3. Avatar for christioanchauvin 13. christioanchauvin Lv 1 63 pts. 12,375
  4. Avatar for grogar7 14. grogar7 Lv 1 60 pts. 12,362
  5. Avatar for anthion 15. anthion Lv 1 58 pts. 12,332
  6. Avatar for georg137 16. georg137 Lv 1 55 pts. 12,328
  7. Avatar for cbwest 17. cbwest Lv 1 53 pts. 12,298
  8. Avatar for fiendish_ghoul 18. fiendish_ghoul Lv 1 51 pts. 12,285
  9. Avatar for Bletchley Park 19. Bletchley Park Lv 1 49 pts. 12,277
  10. Avatar for Skippysk8s 20. Skippysk8s Lv 1 47 pts. 12,252

Comments